PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0450s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22262.4 Da    PI: 6.5544
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0450s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.3e-22956148
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                         krienks rqvtfskRrng++ KA  LS+LCd  vav+++s +gkly 
  Cagra.0450s0030.1.p  9 KRIENKSSRQVTFSKRRNGLIDKARQLSILCDSSVAVVVVSASGKLYN 56
                         79********************************************96 PP

2K-box36.12.8e-13951642998
                K-box  29 enLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          e L+  q +l   ++++Ls+  L +Le+qLe++l+  R++K+el++e+++ lq  e+ l+een+ L +++
  Cagra.0450s0030.1.p  95 ELLEIVQSNLEETNINNLSVDFLISLEEQLENALSVSRARKTELMMESLKSLQGEENLLREENQVLASQM 164
                          66777888899999***************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.231161IPR002100Transcription factor, MADS-box
SMARTSM004326.4E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-27172IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-24323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.17380170IPR002487Transcription factor, K-box
PfamPF014862.4E-996164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGRRKIEIKR IENKSSRQVT FSKRRNGLID KARQLSILCD SSVAVVVVSA SGKLYNSCSG  60
DDMSKIIERY EIQHADELKA LDLAEKTRNY LPHKELLEIV QSNLEETNIN NLSVDFLISL  120
EEQLENALSV SRARKTELMM ESLKSLQGEE NLLREENQVL ASQMGKKNTF LATEDERGIS  180
PKNSSGNQIP ETLPLLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A6e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D6e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3428080.0AF342808.1 Arabidopsis thaliana MADS affecting flowering 1 (MAF1) mRNA, complete cds.
GenBankAK1175770.0AK117577.1 Arabidopsis thaliana mRNA for (NM_148660) MADS affecting flowering 1(MAF1); protein id: At1g77080.4, supported by cDNA: 92459., supported by cDNA: gi_13649968, supported by cDNA: gi_16580104 [Arabidopsis thaliana] gb|AAK37527.1|AF342808_1 (AF342808) MADS affecting flowering 1 [Arabidopsis thaliana] gb|AAK54440.1| (AY034083) MADS box FLC1-like nuclear protein [Arabidopsis thaliana] gb|AAM67028.1| (AY088709) MADS affecting flowering 1 [Arabidopsis thaliana], complete cds, clone: RAFL17-22-J12.
GenBankAK1752470.0AK175247.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL21-67-N06.
GenBankAK1762700.0AK176270.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL23-17-J21.
GenBankAK2279480.0AK227948.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-50-E05.
GenBankAY0340830.0AY034083.1 Arabidopsis thaliana MADS box FLC1-like nuclear protein (FK1) mRNA, complete cds.
GenBankAY0887090.0AY088709.1 Arabidopsis thaliana clone 92459 mRNA, complete sequence.
GenBankBT0045980.0BT004598.1 Arabidopsis thaliana At1g77080 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302848.11e-140hypothetical protein CARUB_v10020979mg
SwissprotQ9FPN71e-108AGL31_ARATH; Agamous-like MADS-box protein AGL31
TrEMBLR0GJ271e-140R0GJ27_9BRAS; Uncharacterized protein
STRINGAT5G65050.31e-106(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77080.41e-104MIKC_MADS family protein